PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG006625t1
Common NameTCM_006625
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 267aa    MW: 28956.3 Da    PI: 6.4134
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG006625t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_123.21.5e-0785134251
                       XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkelee 51 
                       +e k  +r   NReA r++R++ ka+ + Le++v  L a N++L k+l+ 
  Thecc1EG006625t1  85 REKKSKKRPLGNREAVRKYREKVKARAASLEDEVVRLRALNQQLLKRLQG 134
                       5678899999***********************************99974 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.0E-1282152No hitNo description
SMARTSM003386.6E-884151IPR004827Basic-leucine zipper domain
PfamPF077163.5E-1386141IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.66E-588134No hitNo description
CDDcd146862.39E-1090143No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071294Biological Processcellular response to zinc ion
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MDDGELDFLN QEVFSGNMAD IPSSCSMDSF FDELLNDSHA CTHTHTCNPP GPDNSHTHTC  60
FHVHTKIVPA PTEDKAAIDD TAESREKKSK KRPLGNREAV RKYREKVKAR AASLEDEVVR  120
LRALNQQLLK RLQGQAALEA EIARLKCLLV DIRGRIEGEI GSFPYQKSTT NVNMMNLPGA  180
YVMNPCNVQC NDQMYCLHPG ADGKTGEVAE LNGQGFNVCE FDNLPCLANQ NSGEKELSTY  240
GVGSAGSNGN SSGTKRRKGA HAATAG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007041830.10.0Basic-leucine zipper transcription factor family protein isoform 1
RefseqXP_007041826.10.0Basic-leucine zipper transcription factor family protein isoform 1
RefseqXP_007041831.10.0Basic-leucine zipper transcription factor family protein isoform 1
RefseqXP_007041829.10.0Basic-leucine zipper transcription factor family protein isoform 1
SwissprotQ8GTS21e-112BZP23_ARATH; Basic leucine zipper 23
TrEMBLA0A061DZ790.0A0A061DZ79_THECC; Basic-leucine zipper transcription factor family protein isoform 1
STRINGVIT_03s0038g02420.t011e-145(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G16770.11e-110bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]